Gene Rv3866 (snm5)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | ESX-1 secretion-associated protein EspG1 |
| Comments | Rv3866, (MTCY01A6.01c, MTV027.01), len: 283 aa. espG1, ESX-1 secretion-associated protein. N-terminal end highly similar to O33091|MLCB628.20c hypothetical 13.1 KDA protein from Mycobacterium leprae (122 aa), FASTA scores: opt: 260, E(): 2.1e-09, (43.6% identity in 117 aa overlap); and C-terminal end highly similar to O33090|MLCB628.19c hypothetical 36.7 KDA protein from Mycobacterium leprae (338 aa), FASTA scores: opt: 540, E(): 1.4e-26, (54.5% identity in 156 aa overlap). Also similar to Q9CD34|ML2530 possible DNA-binding protein from Mycobacterium leprae (289 aa), FASTA scores: opt: 146, E(): 0.058, (28.25% identity in 269 aa overlap) and O53694|Rv0289|MTV035.17 hypothetical 31.6 KDA protein from Mycobacterium tuberculosis (295 aa), FASTA scores: opt: 133, E(): 0.39, (28.15% identity in 277 aa overlap). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4341880 | 4342731 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3866|espG1
MTGPSAAGRAGTADNVVGVEVTIDGMLVIADRLHLVDFPVTLGIRPNIPQEDLRDIVWEQVQRDLTAQGVLDLHGEPQPTVAEMVETLGRPDRTLEGRWWRRDIGGVMVRFVVCRRGDRHVIAARDGDMLVLQLVAPQVGLAGMVTAVLGPAEPANVEPLTGVATELAECTTASQLTQYGIAPASARVYAEIVGNPTGWVEIVASQRHPGGTTTQTDAAAGVLDSKLGRLVSLPRRVGGDLYGSFLPGTQQNLERALDGLLELLPAGAWLDHTSDHAQASSRG
Bibliography
- Gey Van Pittius NC, Gamieldien J, Hide W, Brown GD, Siezen RJ and Beyers AD [2001]. The ESAT-6 gene cluster of Mycobacterium tuberculosis and other high G+C Gram-positive bacteria. Secondary
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- [2009]. Systematic genetic nomenclature for type VII secretion systems. Nomenclature
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant