Gene Mb3897
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | esx-1 secretion-associated protein esph |
| Comments | Mb3897, -, len: 183 aa. Equivalent to Rv3867, len: 183 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 183 aa overlap). Conserved hypothetical protein, highly similar to the hypothetical proteins from Mycobacterium leprae Q9CDD6|ML0056 (169 aa) FASTA scores: opt: 403, E(): 1.8e-18, (48.2% identity in 166 aa overlap); Q49730|ML0407|B1620_C3_264|MLCL383.03 (216 aa), FASTA scores: opt: 517, E(): 1.7e-25, (51.45% identity in 175 aa overlap); and O33090|MLCB628.19c (338 aa), FASTA scores: opt: 403, E(): 3.4e-18, (48.2% identity in 166 aa overlap). Also highly similar to O06269|Rv3614c|MTCY07H7B.08 HYPOTHETICAL 19.8 KDA PROTEIN from Mycobacterium tuberculosis (184 aa), FASTA scores: opt: 559, E(): 3.4e-28, (54.35% identity in 173 aa overlap). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4279090 | 4279641 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3897|esph
MVDPPGNDDDHGDLDALDFSAAHTNEASPLDALDDYAPVQTDDAEGDLDALHALTERDEEPELELFTVTNPQGSVSVSTLMDGRIQHVELTDKATSMSEAQLADEIFVIADLARQKARASQYTFMVENIGELTDEDAEGSALLREFVGMTLNLPTPEEAAAAEAEVFATRYDVDYTSRYKADD
Bibliography
No article yet recorded
