Gene Rv3867
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | ESX-1 secretion-associated protein EspH |
| Comments | Rv3867, (MTV027.02), len: 183 aa. EspH, ESX-1 secretion-associated protein, highly similar to the hypothetical proteins from Mycobacterium leprae: Q9CDD6|ML0056 (169 aa) FASTA scores: opt: 403, E(): 1.8e-18, (48.2% identity in 166 aa overlap); Q49730|ML0407|B1620_C3_264|MLCL383.03 (216 aa), FASTA scores: opt: 517, E(): 1.7e-25, (51.45% identity in 175 aa overlap); and O33090|MLCB628.19c (338 aa), FASTA scores: opt: 403, E(): 3.4e-18, (48.2% identity in 166 aa overlap). Also highly similar to O06269|Rv3614c|MTCY07H7B.08 hypothetical 19.8 KDA protein from Mycobacterium tuberculosis (184 aa), FASTA scores: opt: 559, E(): 3.4e-28, (54.35% identity in 173 aa overlap). A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4342770 | 4343321 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3867|espH
MVDPPGNDDDHGDLDALDFSAAHTNEASPLDALDDYAPVQTDDAEGDLDALHALTERDEEPELELFTVTNPQGSVSVSTLMDGRIQHVELTDKATSMSEAQLADEIFVIADLARQKARASQYTFMVENIGELTDEDAEGSALLREFVGMTLNLPTPEEAAAAEAEVFATRYDVDYTSRYKADD
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST and Brosch R [2004]. Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex. Homology
- [2009]. Systematic genetic nomenclature for type VII secretion systems. Nomenclature
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant