Gene Mb3918c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | esx-2 secretion-associated protein espg2 |
| Comments | Mb3918c, -, len: 72 aa. Equivalent to 5' end of Rv3889c, len: 276 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 68 aa overlap). Hypothetical unknown protein. REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a deletion of 2406 bases leads to the loss of the NH2 part of Rv3887c, the entire Rv3888c and the COOH part of Rv3889c compared to Mycobacterium tuberculosis strain H37Rv. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4307371 | 4307589 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3918c|espg2
MLTTTVDGLWVLQAVTGVEQTCPELGLRPLLPRLDTAERALRHPVAAELMAVGALDQAGNADPMVREWRLMR
Bibliography
No article yet recorded