Gene Rv3889c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | ESX-2 secretion-associated protein EspG2 |
| Comments | Rv3889c, (MTCY15F10.23), len: 276 aa. EspG2, ESX-2 secretion-associated protein. |
| Functional category | Cell wall and cell processes |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 4h of starvation (see transcriptome citation). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4372800 | 4373630 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3889c|espG2
MLTTTVDGLWVLQAVTGVEQTCPELGLRPLLPRLDTAERALRHPVAAELMAVGALDQAGNADPMVREWLTVLLRRDLGLLVTIGVPGGEPTRAAICRFATWWVVLERHGNLVRLYPAGTASDEAGAGELVVGQVERLCGVAEAAPLRPVTVDADELLHAVRDAGTLRSYLLSQRLDVDQLQMVTMAADPTRSAHATLVALQAGVGPEKSARILVGDSTVAIVDTAAGRICVESVTSGQRRYQVLSPGSRSDIGGAVQRLIRRLPAGDEWYSYRRVV
Bibliography
- Gey Van Pittius NC, Gamieldien J, Hide W, Brown GD, Siezen RJ and Beyers AD [2001]. The ESAT-6 gene cluster of Mycobacterium tuberculosis and other high G+C Gram-positive bacteria. Secondary
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- [2009]. Systematic genetic nomenclature for type VII secretion systems. Nomenclature
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
