Gene Mb3928c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN |
| Comments | Mb3928c, -, len: 293 aa. Equivalent to 3' end of Rv3899c, len: 410 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 293 aa overlap). Conserved hypothetical protein, similar in part to proteins from Mycobacterium tuberculosis strains H37Rv and CDC1551. Region between aa 29-80 is strictly identical to P96909 HYPOTHETICAL 15.1 KDA PROTEIN (FRAGMENT) (143 aa) FASTA scores: opt: 562, E(): 4e-16, (69.0% identity in 142 aa overlap); and the N-terminal end is highly similar, but longer 65 aa, to O07266 HYPOTHETICAL 13.7 KDA PROTEIN (FRAGMENT) (143 aa), FASTA scores: opt: 562, E(): 4e-16,(69.0% identity in 142 aa overlap). Highly similar to C-terminal end of Q10690|YK82_MYCTU|Rv2082|MTCY49.21 HYPOTHETICAL 73.6 KDA PROTEIN (721 aa), FASTA scores: opt: 1388, E(): 1.5e-48, (55.25% identity in 409 aa overlap). And similar to P71599|Rv0029|MTCY10H4.29 HYPOTHETICAL 39.6 KDA PROTEIN (365 aa), FASTA scores: opt: 403, E(): 1.7e-09, (33.75% identity in 252 aa overlap). Note that MTCY15F10.12 and MTCY15F10.13 appear frameshifted with respect to MTCY49.21 although the sequence appears to be correct. REMARK-M.bovis-M.tuberculosis: In Mycobacterium tuberculosis, Rv3899c exists as a single gene. In Mycobacterium bovis, a frameshift due to a single base deletion (c-*) splits Rv3899c into 2 parts, Mb3928c and Mb3929c with the former being the more likely product. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4318109 | 4318990 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3928c|Mb3928c
MAAPAVPSVPTAPVSGAPVAPSASSAPSAGGALVSPVERAASKAVAGQAGASSSTMAGASALSATAGATAGAVSARAAEQQRLQRIVDAVARQEPRISWAAGLRDDGTTTLLVTDLAGGWIPPHVRLPANVTLLEPTARRRDADVIDLLGAVVAVAAHESNTYVAEPGPDAPALTGDRSARSAIPKVDEFGPTLVEAVRRRDSLPRIAQAIALPAVRKTGVLENEAELLHGCITAVKESVLKAYPSHELTAVGDWMLLAAIEALIDEQDYLANYHLAWYAVTTRRGGSRGFAA
Bibliography
No article yet recorded