Gene Rv3899c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3899c, (MTCY15F10.13), len: 410 aa. Conserved hypothetical protein, similar in part to proteins from Mycobacterium tuberculosis strains H37Rv and CDC1551. Region between aa 29-80 is strictly identical to P96909 hypothetical 15.1 KDA protein (fragment) (143 aa) FASTA scores: opt: 562, E(): 4e-16, (69.0% identity in 142 aa overlap); and the N-terminal end is highly similar, but longer 65 aa, to O07266 hypothetical 13.7 KDA protein (fragment) (143 aa), FASTA scores: opt: 562, E(): 4e-16, (69.0% identity in 142 aa overlap). Highly similar to C-terminal end of Q10690|YK82_MYCTU|Rv2082|MTCY49.21 hypothetical 73.6 KDA protein (721 aa), FASTA scores: opt: 1388, E(): 1.5e-48, (55.25% identity in 409 aa overlap). And similar to P71599|Rv0029|MTCY10H4.29 hypothetical 39.6 KDA protein (365 aa), FASTA scores: opt: 403, E(): 1.7e-09, (33.75% identity in 252 aa overlap). Note that MTCY15F10.12 and MTCY15F10.13 appear frameshifted with respect to MTCY49.21 although the sequence appears to be correct. |
| Functional category | Conserved hypotheticals |
| Proteomics | Predicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4384147 | 4385379 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3899c|Rv3899c
MVTGQPAAAGAHSLSEGAMTAMQSGSVPPPQATPPITTPPVVSAPTMAAGIEATHGPVDTPANTSGAPPASTGTTGPVAPTVVTAGPVAAPAAPVVGGSAVPAGPLPAYGSDLRPPVVAAPAVPSVPTAPVSGAPVAPSASSAPSAGGALVSPVERAASKAVAGQAGASSSTMAGASALSATAGATAGAVSARAAEQQRLQRIVDAVARQEPRISWAAGLRDDGTTTLLVTDLAGGWIPPHVRLPANVTLLEPTARRRDADVIDLLGAVVAVAAHESNTYVAEPGPDAPALTGDRSARSAIPKVDEFGPTLVEAVRRRDSLPRIAQAIALPAVRKTGVLENEAELLHGCITAVKESVLKAYPSHELTAVGDWMLLAAIEALIDEQDYLANYHLAWYAVTTRRGGSRGFAA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- MÃ¥len H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant