Gene Mb3936c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN |
| Comments | Mb3936c, -, len: 169 aa. Equivalent to Rv3906c,len: 169 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 169 aa overlap). Conserved hypothetical protein, strongly related to Q50578|AT9S (SOD related in Escherichia coli) from Mycobacterium tuberculosis strain AOYAMA B (155 aa), but apparently different as flanking sequences differ and shorter 43 aa,FASTA scores: opt: 548, E(): 1.3e-26, (79.4% identity in 102 aa overlap). Selfmarch results suggest that Rv3906c is not related to any other hypothetical protein from M. tuberculosis strain H37Rv except itself. Shows also similarity with Q9VFR2|CG9297 HYPOTHETICAL PROTEIN from Drosophila melanogaster (Fruit fly) (930 aa), FASTA scores: opt: 221, E(): 4.9e-06, (36.95% identity in 157 aa overlap); Q9HQ55|CBP|VNG1320G CALCIUM-BINDING PROTEIN HOMOLOGY from Halobacterium sp. strain NRC-1 (385 aa) FASTA scores: opt: 143, E(): 0.13, (35.65% identity in 160 aa overlap); Q24795 CALCIUM-BINDING PROTEIN (FRAGMENT) from Echinococcus granulosus (338 aa), FASTA scores: opt: 140, E(): 0.17, (33.95% identity in 156 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4325058 | 4325567 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3936c|Mb3936c
MEYCIAGDDGSAGIWNRPFDVDLDGDGRLDAIGLDLDGDGLRDDALADFDGDDVADHAVFDVDNDGTPESYFIDDGSGTWAVAVDRGGQLRWYGLDGVEHTGGPLVDFDGFGGLDDRLLDTDGDGLADRVLCAGEQRVTGYVDTDGDGRWDVRLTDTDGDGTADGASSL
Bibliography
No article yet recorded
