Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv3906c, (MTCY15F10.05), len: 169 aa. Conserved hypothetical protein, strongly related to Q50578|AT9S (sod related in Escherichia coli) from Mycobacterium tuberculosis strain aoyama B (155 aa), but apparently different as flanking sequences differ and shorter 43 aa, FASTA scores: opt: 548, E(): 1.3e-26, (79.4% identity in 102 aa overlap). Selfmarch results suggest that Rv3906c is not related to any other hypothetical protein from Mycobacterium tuberculosis strain H37Rv except itself. Shows also similarity with Q9VFR2|CG9297 hypothetical protein from Drosophila melanogaster (Fruit fly) (930 aa), FASTA scores: opt: 221, E(): 4.9e-06, (36.95% identity in 157 aa overlap); Q9HQ55|CBP|VNG1320G calcium-binding protein homology from Halobacterium sp. strain NRC-1 (385 aa) FASTA scores: opt: 143, E(): 0.13, (35.65% identity in 160 aa overlap); Q24795 calcium-binding protein (fragment) from Echinococcus granulosus (338 aa), FASTA scores: opt: 140, E(): 0.17, (33.95% identity in 156 aa overlap).
Functional categoryConserved hypotheticals
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS43910974391606-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3906c|Rv3906c
VEYCIAGDDGSAGIWNRPFDVDLDGDGRLDAIGLDLDGDGLRDDALADFDGDDVADHAVFDVDNDGTPESYFIDDGSGTWAVAVDRGGQLRWYGLDGVEHTGGPLVDFDGFGGLDDRLLDTDGDGLADRVLCAGEQRVTGYVDTDGDGRWDVRLTDTDGDGTADGASSL