Gene Mb3941
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | POSSIBLE ALTERNATIVE RNA POLYMERASE SIGMA FACTOR SIGMa [FIRST PART] |
| Comments | Mb3941, sigMa, len: 196 aa. Similar to Rv3911, len: 222 aa, from Mycobacterium tuberculosis strain H37Rv,(95.8% identity in 168 aa overlap). Possible sigM,alternative RNA polymerase sigma factor (see citation below), highly similar to others e.g. Q9S6U3|SCH24.14c (alias O86856|SIGT) PUTATIVE RNA POLYMERASE SIGMA FACTOR from Streptomyces coelicolor (236 aa), FASTA scores: opt: 336, E(): 2.8e-13, (41.5% identity in 212 aa overlap); Q98KG8|MLR1481 PROBABLE RNA POLYMERASE SIGMA SUBUNIT from Rhizobium loti (Mesorhizobium loti) (307 aa), FASTA scores: opt: 221, E(): 2.9e-06, (32.95% identity in 179 aa overlap); Q9A4S9|CC2751 PUTATIVE RNA POLYMERASE SIGMA FACTOR from Caulobacter crescentus (186 aa), FASTA scores: opt: 217, E(): 3.3e-06, (36.95% identity in 138 aa overlap); etc. Also similarity with other mycobacterial factors e.g. O06289|SIGE|Rv1221|MTCI61.04 PUTATIVE RNA POLYMERASE SIGMA FACTOR from Mycobacterium tuberculosis (257 aa), FASTA scores: opt: 193, E(): 0.00012, (33.15% identity in 163 aa overlap); and O05735|SIGE PUTATIVE RNA POLYMERASE SIGMA FACTOR from Mycobacterium avium (251 aa),FASTA scores: opt: 192, E(): 0.00014, (33.15% identity in 163 aa overlap). Equivalent to AAK48395|MT4030 RNA POLYMERASE SIGMA-70 FACTOR from Mycobacterium tuberculosis strain CDC1551 (196 aa) but without similarity at the C-terminal end. BELONGS TO THE SIGMA-70 FACTOR FAMILY, ECF SUBFAMILY. REMARK-M.bovis-M.tuberculosis: In Mycobacterium tuberculosis, sigM exists as a single gene. In Mycobacterium bovis, a frameshift due to a 2bp to 1bp substitution (cg-t) splits sigM into 2 parts, sigMa and sigMb. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4334147 | 4334737 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3941|sigMa
MPPPIGYCPAVGFGGRHERSDAELLAAHVAGDRYAFDQLFRRHHRQLHRLARLTSRTSEDADDALQDAMLSAHRGAGSFRYDAAVSSWLHRIVVNACLDRLRRAKAHPTAPLEDVYPVADRTAQVETAIAVQRALMRLPVEQRAAVVAVDMQGYSIADTSRMLGVAEGTVKSRCARARARLARLLGYLNTGVNIRR
Bibliography
No article yet recorded