Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThe sigma factor is an initiation factor that promotes attachment of the RNA polymerase to specific initiation sites and then is released.
ProductPossible alternative RNA polymerase sigma factor SigM
CommentsRv3911, (MTV028.02), len: 222 aa. Possible sigM, alternative RNA polymerase sigma factor (see Gomez et al., 1997; Chen et al., 2000), highly similar to others e.g. Q9S6U3|SCH24.14c (alias O86856|SIGT) putative RNA polymerase sigma factor from Streptomyces coelicolor (236 aa), FASTA scores: opt: 336, E(): 2.8e-13, (41.5% identity in 212 aa overlap); Q98KG8|MLR1481 probable RNA polymerase sigma subunit from Rhizobium loti (Mesorhizobium loti) (307 aa), FASTA scores: opt: 221, E(): 2.9e-06, (32.95% identity in 179 aa overlap); Q9A4S9|CC2751 putative RNA polymerase sigma factor from Caulobacter crescentus (186 aa), FASTA scores: opt: 217, E(): 3.3e-06, (36.95% identity in 138 aa overlap); etc. Also similarity with other mycobacterial factors e.g. O06289|SIGE|Rv1221|MTCI61.04 putative RNA polymerase sigma factor from Mycobacterium tuberculosis (257 aa), FASTA scores: opt: 193, E(): 0.00012, (33.15% identity in 163 aa overlap); and O05735|SIGE putative RNA polymerase sigma factor from Mycobacterium avium (251 aa), FASTA scores: opt: 192, E(): 0.00014, (33.15% identity in 163 aa overlap). Equivalent to AAK48395|MT4030 RNA polymerase sigma-70 factor from Mycobacterium tuberculosis strain CDC1551 (196 aa) but without similarity at the C-terminal end. Belongs to the sigma-70 factor family, ECF subfamily.
Functional categoryInformation pathways
ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
TranscriptomicsmRNA identified by real-time quantitative RT-PCR during exponential growing cultures. mRNA level decreased under stress conditions (0.05% SDS) (see Manganelli et al., 1999).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, but essential for in vitro growth on cholesterol; by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Growth of M. tuberculosis H37Rv sigM|Rv3911 mutant in vitro and in vitro under oxidative stresses is comparable to wild-type; TLC shows mutant has increased PDIM synthesis and no PDIM when sigM|Rv3911 is overexpressed (See Raman et al., 2006).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS44001864400854+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
>Mycobacterium tuberculosis H37Rv|CDS|Rv3911|4400186-4400854|+|sigM|downstream:0|upstream:0
atgccgccaccgattggttactgtccggccgtgggtttcgggggccgtcacgagcgcagcgacgccgagctgctggccgcccatgtcgccggcgaccggtacgccttcgatcagttgttccgccgtcatcaccgccagctacaccggctcgcgcggctcaccagccggacctccgaggacgccgacgatgcgctgcaagacgcgatgctgtcagcgcaccgcggcgccggctcgttccggtacgatgccgccgtcagcagttggttgcaccgcatcgtggtcaacgcttgcctggaccggctgcgtcgggccaaagcccatccgaccgcccctctagaagatgtctatccggtcgcggaccggaccgcgcaggtcgagaccgcgatcgcggtgcagcgggcactgatgcggctgcccgtcgagcagcgggccgcggtggtcgccgtggacatgcagggctattcgatcgccgacacccgcccggatgctgggcgtggccgagggcaccgtcaagagccgctgcgcccgggcgcgggcccgcctagcgcggctgctgggctatctcaacaccggggtgaacatccggcgctgaccccgttgccggtccgtcgtagcatcgatccacgggctcgccgctaccccacatctggctattgccaccgggcatga
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3911|sigM
MPPPIGYCPAVGFGGRHERSDAELLAAHVAGDRYAFDQLFRRHHRQLHRLARLTSRTSEDADDALQDAMLSAHRGAGSFRYDAAVSSWLHRIVVNACLDRLRRAKAHPTAPLEDVYPVADRTAQVETAIAVQRALMRLPVEQRAAVVAVDMQGYSIADTRPDAGRGRGHRQEPLRPGAGPPSAAAGLSQHRGEHPALTPLPVRRSIDPRARRYPTSGYCHRA