Gene Rv3911
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | The sigma factor is an initiation factor that promotes attachment of the RNA polymerase to specific initiation sites and then is released. |
| Product | Possible alternative RNA polymerase sigma factor SigM |
| Comments | Rv3911, (MTV028.02), len: 222 aa. Possible sigM, alternative RNA polymerase sigma factor (see Gomez et al., 1997; Chen et al., 2000), highly similar to others e.g. Q9S6U3|SCH24.14c (alias O86856|SIGT) putative RNA polymerase sigma factor from Streptomyces coelicolor (236 aa), FASTA scores: opt: 336, E(): 2.8e-13, (41.5% identity in 212 aa overlap); Q98KG8|MLR1481 probable RNA polymerase sigma subunit from Rhizobium loti (Mesorhizobium loti) (307 aa), FASTA scores: opt: 221, E(): 2.9e-06, (32.95% identity in 179 aa overlap); Q9A4S9|CC2751 putative RNA polymerase sigma factor from Caulobacter crescentus (186 aa), FASTA scores: opt: 217, E(): 3.3e-06, (36.95% identity in 138 aa overlap); etc. Also similarity with other mycobacterial factors e.g. O06289|SIGE|Rv1221|MTCI61.04 putative RNA polymerase sigma factor from Mycobacterium tuberculosis (257 aa), FASTA scores: opt: 193, E(): 0.00012, (33.15% identity in 163 aa overlap); and O05735|SIGE putative RNA polymerase sigma factor from Mycobacterium avium (251 aa), FASTA scores: opt: 192, E(): 0.00014, (33.15% identity in 163 aa overlap). Equivalent to AAK48395|MT4030 RNA polymerase sigma-70 factor from Mycobacterium tuberculosis strain CDC1551 (196 aa) but without similarity at the C-terminal end. Belongs to the sigma-70 factor family, ECF subfamily. |
| Functional category | Information pathways |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Transcriptomics | mRNA identified by real-time quantitative RT-PCR during exponential growing cultures. mRNA level decreased under stress conditions (0.05% SDS) (see Manganelli et al., 1999). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, but essential for in vitro growth on cholesterol; by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Growth of M. tuberculosis H37Rv sigM|Rv3911 mutant in vitro and in vitro under oxidative stresses is comparable to wild-type; TLC shows mutant has increased PDIM synthesis and no PDIM when sigM|Rv3911 is overexpressed (See Raman et al., 2006). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4400186 | 4400854 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3911|sigM
MPPPIGYCPAVGFGGRHERSDAELLAAHVAGDRYAFDQLFRRHHRQLHRLARLTSRTSEDADDALQDAMLSAHRGAGSFRYDAAVSSWLHRIVVNACLDRLRRAKAHPTAPLEDVYPVADRTAQVETAIAVQRALMRLPVEQRAAVVAVDMQGYSIADTRPDAGRGRGHRQEPLRPGAGPPSAAAGLSQHRGEHPALTPLPVRRSIDPRARRYPTSGYCHRA
Bibliography
- Gomez JE et al. [1997]. Sigma factors of Mycobacterium tuberculosis. Review
- Manganelli R et al. [1999]. Differential expression of 10 sigma factor genes in Mycobacterium tuberculosis. Transcriptome
- Chen P, Gomez J and Bishai WR [2000]. http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Retrieve&list_uids=&dopt=Abstract Review
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Raman S et al. [2006]. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. Mutant Regulon
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
