Gene Rv0153c (MPtpB)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in signal transduction (via dephosphorylation). Can dephosphorylate in vitro the phosphotyrosine residue of myelin basic protein (MBP) at pH 7.0. Could be involved in virulence by interfering with phosphotyrosine-mediated signals in macrophages. Also able to dephosphorylate phosphoserine/threonine peptides and phosphoinositide substrates. [catalytic activity: protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate] |
| Product | Phosphotyrosine protein phosphatase PTPB (protein-tyrosine-phosphatase) (PTPase) |
| Comments | Rv0153c, (MTCI5.27c), len: 276 aa. PtbB (alternate gene name: MPtpB), protein-tyrosine-phosphatase (see citation below), showing some similarity to several protein-tyrosine phosphatases, polyketide synthase and aminotransferase e.g. Q05918|IPHP_NOSCO|IPH protein-tyrosine-phosphatase precursor from Nostoc commune (294 aa), FASTA scores: opt: 150, E(): 0.0096, (26.8% identity in 269 aa overlap); etc. Supposedly a secreted protein. Potent and selective inhibitor is an isoxazole compound (See Seollner et al., 2007). |
| Functional category | Regulatory proteins |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv on cholesterol, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). M. tuberculosis Erdman mptpB mutant is attenuated in activated macrophages and guinea pigs but not in resting macrophages (See Singh et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 181155 | 181985 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0153c|ptbB
MAVRELPGAWNFRDVADTATALRPGRLFRSSELSRLDDAGRATLRRLGITDVADLRSSREVARRGPGRVPDGIDVHLLPFPDLADDDADDSAPHETAFKRLLTNDGSNGESGESSQSINDAATRYMTDEYRQFPTRNGAQRALHRVVTLLAAGRPVLTHCFAGKDRTGFVVALVLEAVGLDRDVIVADYLRSNDSVPQLRARISEMIQQRFDTELAPEVVTFTKARLSDGVLGVRAEYLAAARQTIDETYGSLGGYLRDAGISQATVNRMRGVLLG
Bibliography
- Koul A et al. [2000]. Cloning and characterization of secretory tyrosine phosphatases of Mycobacterium tuberculosis. Product Biochemistry Function
- Singh R, Rao V, Shakila H, Gupta R, Khera A, Dhar N, Singh A, Koul A, Singh Y, Naseema M, Narayanan PR, Paramasivan CN, Ramanathan VD and Tyagi AK [2003]. Disruption of mptpB impairs the ability of Mycobacterium tuberculosis to survive in guinea pigs. Mutant
- Grundner C et al. [2005]. Mycobacterium tuberculosis protein tyrosine phosphatase PtpB structure reveals a diverged fold and a buried active site. Structure
- Soellner MB, Rawls KA, Grundner C, Alber T and Ellman JA [2007]. Fragment-based substrate activity screening method for the identification of potent inhibitors of the Mycobacterium tuberculosis phosphatase PtpB. Function
- Beresford N et al. [2007]. MptpB, a virulence factor from Mycobacterium tuberculosis, exhibits triple-specificity phosphatase activity. Function
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant