Gene Rv0156 (pntAB)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | The transhydrogenation between NADH and NADP is coupled to respiration and ATP hydrolysis and functions as a proton pump across the membrane [catalytic activity: NADPH + NAD+ = NADP+ + NADH]. |
| Product | Probable NAD(P) transhydrogenase (subunit alpha) PntAb [second part; integral membrane protein] (pyridine nucleotide transhydrogenase subunit alpha) (nicotinamide nucleotide transhydrogenase subunit alpha) |
| Comments | Rv0156, (MTCI5.30), len: 110 aa. Probable pntAb, second part of NAD(P) transhydrogenase subunit alpha, integral membrane protein, similar to C-terminus of others e.g. Q59764 nicotinamide nucleotide transhydrogenase subunit PNTAB (139 aa), FASTA scores: opt: 247, E(): 1.9e-11, (45.5% identity in 88 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | non essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 184723 | 185055 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0156|pntAb
MYNELLENLAILVLSGFVGFAVISKVPNTLHTPLMSGTNAIHGIVVLGALVVFGEIEHPSLVLQVILFVAVVFGTLNVIGGFIVTDRMLGMFKAKKPAVPAKPDRDEALR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
