Gene Rv0238
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Possibly involved in transcriptional mechanism. |
| Product | Possible transcriptional regulatory protein (probably TetR-family) |
| Comments | Rv0238, (MTV034.04), len: 204 aa. Possible transcriptional regulatory protein, TetR family, equivalent to AL022486|MLCB1883_9|T44874 probable transcription regulator from Mycobacterium leprae (208 aa), FASTA scores: opt: 1029, E(): 0, (80.9% identity in 199 aa overlap). Also similar to others e.g. CAB77290.1|AL160312 putative TetR-family regulatory protein from Streptomyces coelicolor (240 aa). Also similar to Mycobacterium tuberculosis proteins Z95120|Rv3208 (228 aa), FASTA scores: opt: 266, E(): 8.3e-12, (28.1% identity in 196 aa overlap); and Rv1019 (197 aa). |
| Functional category | Regulatory proteins |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis and down-regulated after 24h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 288428 | 289042 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0238|Rv0238
MAGGTKRLPRAVREQQMLDAAVQMFSVNGYHETSMDAIAAEAQISKPMLYLYYGSKEDLFGACLNREMSRFIDALRSSINFDQSPKDLLRNTIVSFLRYIDANRASWIVMYTQATSSQAFAHTVREGREQIVQLVAELVRAGTRGPLTDAEIEMMAVALVGAGEAVATRLGIGDTDVDEAAEMMINLFWLGLKGAPVDRLETGH
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
