Gene Rv0262c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Confers resistance to aminoglycosides (gentamicin, tobramycin, dibekacin, netilmicin, and 6'-N-ethylnetilmicin). |
| Product | Aminoglycoside 2'-N-acetyltransferase Aac (Aac(2')-IC) |
| Comments | Rv0262c, (MTCY06A4.06c), len: 181 aa. Aac, aminoglycoside 2'-N-acetyltransferase (aac(2')-IC) (see citation below), highly similar to NP_302635.1|NC_002677 aminoglycoside 2'-N-acetyltransferase from Mycobacterium leprae (182 aa); Q49157|AAC2_MYCFO|AAC aminoglycoside 2'-N-acetyltransferase from Mycobacterium fortuitum (195 aa), Contains GNAT (Gcn5-related N-acetyltransferase) domain. See Vetting et al. 2005. FASTA scores: opt: 884, E(): 0, (69.1% identity in 181 aa overlap); and P94968|AAC2_MYCSM|AAC aminoglycoside 2'-N-acetyltransferase from Mycobacterium smegmatis (210 aa) (see also citation below). Also similar to Q52424|AAC2_PROST aminoglycoside 2'-N-acetyltransferase from Providencia stuartii (178 aa). Belongs to the AAC(2')-I family of acetyltransferases. Note that previously known as aac(2')-IC. |
| Functional category | Virulence, detoxification, adaptation |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 314309 | 314854 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0262c|aac
VHTQVHTARLVHTADLDSETRQDIRQMVTGAFAGDFTETDWEHTLGGMHALIWHHGAIIAHAAVIQRRLIYRGNALRCGYVEGVAVRADWRGQRLVSALLDAVEQVMRGAYQLGALSSSARARRLYASRGWLPWHGPTSVLAPTGPVRTPDDDGTVFVLPIDISLDTSAELMCDWRAGDVW
Bibliography
- Ainsa JA, Perez E, Pelicic V, Berthet FX, Gicquel B and Martin C [1997]. Aminoglycoside 2'-N-acetyltransferase genes are universally present in mycobacteria: characterization of the aac(2')-Ic gene from Mycobacterium tuberculosis and the aac(2')-Id gene from Mycobacterium smegmatis. Sequence
- Vetting MW et al. [2002]. Aminoglycoside 2'-N-acetyltransferase from Mycobacterium tuberculosis in complex with coenzyme A and aminoglycoside substrates. Structure
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Vetting MW et al. [2005]. Structure and functions of the GNAT superfamily of acetyltransferases. Biochemistry
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant