Gene Rv0341
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Isoniazid inductible gene protein IniB |
| Comments | Rv0341, (MTCY13E10.01), len: 479 aa. IniB, isoniazid-inducible gene, (see citations below). Protein very Gly-, Ala-rich, similar to cell wall proteins e.g. P27483|GRP_ARATH glycine-rich cell wall structural protein from A.thaliana (338 aa), FASTA scores: opt: 532, E(): 5.2e-13, (39.3% identity in 321 aa overlap). MEME-mast analysis shows similarity to product of upstream gene, Rv0340. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Transcriptomics | mRNA identified by DNA microarray analysis (gene induced by isoniazid (INH) or ethionamide treatment) (see Wilson et al., 1999). mRNA expression also studied in human lung granulomas of tuberculosis patients (see Fenhalls et al., 2002). DNA microarrays show lower level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006). Quantitative PCR shows INH-mediated induction of iniB|Rv0341, iniA|Rv0342 and iniC|Rv0343 is repressed in M. tuberculosis H37Rv overexpressing lsr2|Rv3597c (See Colangeli et al., 2007). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 409362 | 410801 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0341|iniB
MTSLIDYILSLFRSEDAARSFVAAPGRAMTSAGLIDIAPHQISSVAANVVPGLNLGAGDPMSGLRQAVAARHGFAQDVANVGFAGDAGAGVASVITTDVGAGLASGLGAGFLGQGGLALAASSGGFGGQVGLAAQVGLGFTAVIEAEVGAQVGAGLGIGTGLGAQAGMGFGGGVGLGLGGQAGGVIGGSAAGAIGAGVGGRLGGNGQIGVAGQGAVGAGVGAGVGGQAGIASQIGVSAGGGLGGVGNVSGLTGVSSNAVLASNASGQAGLIASEGAALNGAAMPHLSGPLAGVGVGGQAGAAGGAGLGFGAVGHPTPQPAALGAAGVVAKTEAAAGVVGGVGGATAAGVGGAHGDILGHEGAALGSVDTVNAGVTPVEHGLVLPSGPLIHGGTGGYGGMNPPVTDAPAPQVPARAQPMTTAAEHTPAVTQPQHTPVEPPVHDKPPSHSVFDVGHEPPVTHTPPAPIELPSYGLFGLPGF
Bibliography
- Alland D, Kramnik I, Weisbrod TR, Otsubo L, Cerny R, Miller LP, Jacobs Jr WR and Bloom BR [1998]. Identification of differentially expressed mRNA in prokaryotic organisms by customized amplification libraries (DECAL): the effect of isoniazid on gene expression in Mycobacterium tuberculosis. Regulation
- Wilson M, DeRisi J, Kristensen HH, Imboden P, Rane S, Brown PO and Schoolnik GK [1999]. Exploring drug-induced alterations in gene expression in Mycobacterium tuberculosis by microarray hybridization. Regulation
- Alland D et al. [2000]. Characterization of the Mycobacterium tuberculosis iniBAC promoter, a promoter that responds to cell wall biosynthesis inhibition. Regulation
- Fenhalls G, Stevens L, Moses L, Bezuidenhout J, Betts JC, Helden Pv P, Lukey PT and Duncan K [2002]. In situ detection of Mycobacterium tuberculosis transcripts in human lung granulomas reveals differential gene expression in necrotic lesions. Transcriptome Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Raman S, Hazra R, Dascher CC and Husson RN [2004]. Transcription regulation by the Mycobacterium tuberculosis alternative sigma factor SigD and its role in virulence. Regulon
- Walters SB et al. [2006]. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Transcriptome
- Colangeli R et al. [2007]. Transcriptional regulation of multi-drug tolerance and antibiotic-induced responses by the histone-like protein Lsr2 in M. tuberculosis. Transcriptome
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
