Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionStimulates, jointly with DNAJ|Rv0352, the ATPase activity of DNAK|Rv0350. HELPS to release ADP from DNAK thus allowing DNAK to recycle more efficiently. Seems to be regulated negatively by HSPR (Rv0353 product).
ProductProbable GrpE protein (HSP-70 cofactor)
CommentsRv0351, (MTCY13E10.11), len: 235 aa. Probable grpE protein (HSP-70 cofactor), equivalent to CAC32012.1|AL583925 Hsp70 cofactor from Mycobacterium leprae (229 aa). Also highly similar to others eg Q05562|GRPE_STRCO|2127521|PN0643 GRPE protein from Streptomyces coelicolor (225 aa). Contains grpE protein signature (PS01071). Belongs to the GrpE family.
Functional category-
ProteomicsIdentified by proteomics (see proteomics citations). Level decreases during starvation. Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
TranscriptomicsmRNA identified by DNA microarray analysis and highly up-regulated at high temperatures, and possibly down-regulated by hspR/Rv0353 and hrcA|Rv2374c (see Stewart et al., 2002).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS421709422416+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0351|grpE
VTDGNQKPDGNSGEQVTVTDKRRIDPETGEVRHVPPGDMPGGTAAADAAHTEDKVAELTADLQRVQADFANYRKRALRDQQAAADRAKASVVSQLLGVLDDLERARKHGDLESGPLKSVADKLDSALTGLGLVAFGAEGEDFDPVLHEAVQHEGDGGQGSKPVIGTVMRQGYQLGEQVLRHALVGVVDTVVVDAAELESVDDGTAVADTAENDQADQGNSADTSGEQAESEPSGS
      
Bibliography