Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown; probably involved in cellular metabolism.
ProductPossible oxidoreductase
CommentsRv0370c, (MTV036.05c), len: 298 aa. Possible oxidoreductase, similar to many hypothetical proteins, but also similar to ORF4|X82447|OCCOXMSL4_4 Protein of coxMSL gene cluster from Pseudomonas/Oligotropha carboxidovorans (295 aa), FASTA scores: opt: 851, E(): 0, (48.2% identity in 282 aa overlap); AJ224684|BJAJ4684_3 cooxS from Bradyrhizobium japonicum (302 aa), FASTA scores: opt: 881, E(): 0, (47.6% identity in 290 aa overlap). Also highly similar to MTCY428_21 from Mycobacterium tuberculosis. Contains PS00017 ATP/GTP-binding site motif A (P-loop).
Functional categoryIntermediary metabolism and respiration
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS447147448043-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0370c|Rv0370c
VTFASPDDVIRRFDEQNYLLDTGTASAIYLAVTLGRPLLLEGEPGVGKTTAAKTLAVVLDTTLIRLQCYEGLTANEALYDWNYQRQLLSIRLAEARGKGISDISEADLYTEAYLVDRPILRCVRHRGPTPPVLLIDEIDRADDEFEALLLEFLGESAVTVPELGTFLAECPPIAVLTSNRSRDLHDALRRRCLYHWIDYPGPDRAAAIVRRTVPGATAPLIENATQFVCTARDLDLDKPPGVAETIDWVAALVALGVADLTAADSSPALASLGALAKTPDDRTQIRDAYQAFTECSHA