Gene Rv0387c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv0387c, (MTV036.22c), len: 244 aa. Conserved hypothetical protein, showing some similarity to MTCI237.20c, and M17282|HUMEL20_1 Human elastin gene, exon 1, Elastin (687 aa), FASTA scores: opt: 193, E(): 0.35, (34.4% identity in 189 aa overlap). |
| Functional category | Conserved hypotheticals |
| Transcriptomics | DNA microarrays detect expression in M. tuberculosis H37Rv in vivo (in BALB/c and SCID mice) but not in vitro (in 7H9 medium) (See Talaat et al., 2004). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 466672 | 467406 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0387c|Rv0387c
VSLLPTLQSFLPPPFDAIPNPIEDLDVLVAAAVAVAAGSLGVSAAQLGEIYRHDVVDEAQKAPHCPAESDQTPAGAAGDGDLPEVGGRVTSPPQPPVAALTGYSANIGGLSVPHSWNLPPAVRQVAAMFPGATPMYMTGSSDGSYAGLAAAGLAGTGLAGLAARGGSAPTPAAAAPAGAGGAGPAATRPAAQQTPAVPAAAAGSAIPGLPPGLPPGVVANLAATLAAIPGATIIVVPPSPNANQ
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Talaat AM et al. [2004]. The temporal expression profile of Mycobacterium tuberculosis infection in mice. Transcriptome
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
