Gene Rv0446c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved transmembrane protein |
| Comments | Rv0446c, (MTV037.10c), len: 256 aa. Possible conserved transmembrane protein, similar at N-terminus to U1740AF|U15183|MLU15183_40 from Mycobacterium leprae (117 aa), FASTA scores: opt: 175, E(): 2.5e-05, (62.5% identity in 40 aa overlap); and at C-terminus to AL021529|SC10A5_3 from Streptomyces coelicolor (226 aa), FASTA scores: opt: 207, E(): 9.8e-07, (34.2% identity in 114 aa overlap). Also similar to others hypothetical proteins e.g. AAK04680.1|AE006291_14|AE006291 hypothetical protein from Lactococcus lactis subsp. lactis (257 aa). |
| Functional category | Cell wall and cell processes |
| Proteomics | Predicted transmembrane protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 534445 | 535215 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0446c|Rv0446c
VVTSVSALAVAVVHSVAFAIGRRIGRYNVVDVVWGLGFVAVAVAAATLGHGDPVRRWLLLALVSTWGLRLSWHMYRKTAGQGEDPRYADLLRGATPVQALRKVFGLQGLLTLFVSFPLQLSAVTGPTPKPLLAVGGVGLAVWLVGITFEAVGDWQLWVFKSDPANRGVIMDRGLWAWTRHPNYFGDACVWWGLWLITINDWAPLATVGSPLLMTYLLVDVSGARLTERYLKGRPGFAEYQRRTAYFVPRPPRSARR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- MÃ¥len H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant