Gene Rv0452
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Possibly involved in transcriptional mechanism. |
Product | Possible transcriptional regulatory protein |
Comments | Rv0452, (MTV037.16), len: 236 aa. Possible transcriptional regulator, similar to several putative TetR-family transcriptional regulators from Streptomyces coelicolor. Also similar in N-terminus to U1740Y|U15183|MLU15183_33 from Mycobacterium leprae (67 aa), FASTA score: (76.1% identity in 67 aa overlap). Contains probable helix-turn-helix motif at aa 44-65 (Score 1727, +5.07 SD). |
Functional category | Regulatory proteins |
Transcriptomics | mRNA identified by DNA microarray analysis and up-regulated at high temperatures (see citation below). |
Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 542142 | 542852 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0452|Rv0452 VRYPLAVAQLGFQRARTEENKRQRAAALVEAARSLALETGVASVTLTAVAGRAGIHYSAVRRYFTSHKEVLLHLAAEGWARWSGTVCEQLGEPGPMSAPRVAEALANGLAADPLFCDLLANLHLHLEQEVDVDRVIEVKRTSIAAVIALVDAIESALPALGRSGAFDILLAAYSLAATLWQIANPPERLTDAYAEEPELLPPEWNLDFAAALTRLLTATLLGLLAGSPCECRSPTR
Bibliography
- Gold B et al. [2001]. The Mycobacterium tuberculosis IdeR is a dual functional regulator that controls transcription of genes involved in iron acquisition, iron storage and survival in macrophages. Regulon
- Stewart GR et al. [2002]. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Transcriptome Mutant Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Prakash P et al. [2005]. Computational prediction and experimental verification of novel IdeR binding sites in the upstream sequences of Mycobacterium tuberculosis open reading frames. Regulon
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant