Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionPossibly involved in transcriptional mechanism.
ProductPossible transcriptional regulatory protein
CommentsRv0452, (MTV037.16), len: 236 aa. Possible transcriptional regulator, similar to several putative TetR-family transcriptional regulators from Streptomyces coelicolor. Also similar in N-terminus to U1740Y|U15183|MLU15183_33 from Mycobacterium leprae (67 aa), FASTA score: (76.1% identity in 67 aa overlap). Contains probable helix-turn-helix motif at aa 44-65 (Score 1727, +5.07 SD).
Functional categoryRegulatory proteins
TranscriptomicsmRNA identified by DNA microarray analysis and up-regulated at high temperatures (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS542142542852+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0452|Rv0452
VRYPLAVAQLGFQRARTEENKRQRAAALVEAARSLALETGVASVTLTAVAGRAGIHYSAVRRYFTSHKEVLLHLAAEGWARWSGTVCEQLGEPGPMSAPRVAEALANGLAADPLFCDLLANLHLHLEQEVDVDRVIEVKRTSIAAVIALVDAIESALPALGRSGAFDILLAAYSLAATLWQIANPPERLTDAYAEEPELLPPEWNLDFAAALTRLLTATLLGLLAGSPCECRSPTR