Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in porphyrin biosynthesis by the C5 pathway (at the first step) [catalytic activity: glutamyl-tRNA(GLU) + NADPH = glutamate-1-semialdehyde + NADP+ + tRNA(GLU)].
ProductProbable glutamyl-tRNA reductase HemA (GLUTR)
CommentsRv0509, (MTCY20G9.36), len: 468 aa. Probable hemA, glutamyl-tRNA reductase, equivalent to HEM1_MYCLE|P46724 glutamyl-tRNA reductase from Mycobacterium leprae (467 aa), FASTA scores: opt: 2377, E(): 0, (82.3% identity in 463 aa overlap). Also highly similar (sometimes in part) to others e.g. Q9WX15|HEM1_STRCO glutamyl-tRNA reductase from Streptomyces coelicolor (581 aa); P16618|HEM1_BACSU|HEMA glutamyl-tRNA reductase from Bacillus subtilis (455 aa); etc. Contains PS00747 Glutamyl-tRNA reductase signature. Belongs to the glutamyl-tRNA reductase family.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS600441601847+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0509|hemA
VSVLLFGVSHRSAPVVVLEQLSIDESDQVKIIDRVLASPLVTEAMVLSTCNRVEVYAVVDAFHGGLSVIGQVLAEHSGMSMGELTKYAYVRYSEAAVEHLFAVASGLDSAVIGEQQVLGQVRRAYAVAESNRTVGRVLHELAQRALSVGKRVHSETAIDAAGASVVSVALGMAERKLGSLAGTTAVVIGAGAMGALSAVHLTRAGVGHIQVLNRSLSRAQRLARRIRESGVPAEALALDRLANVLADADVVVSCTGAVRPVVSLADVHHALAAARRDEATRPLVICDLGMPRDVDPAVARLPCVWVVDVDSVQHEPSAHAAAADVEAARHIVAAEVASYLVGQRMAEVTPTVTALRQRAAEVVEAELLRLDNRLPGLQSVQREEVARTVRRVVDKLLHAPTVRIKQLASAPGGDSYAEALRELFELDQTAVDAVATAGELPVVPSGFDAESRRGGGDMQSSPKRSPSN