Gene Rv0512
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Involved in porphyrin and heme biosynthesis (at the second step) [catalytic activity: 2 5-aminolevulinate = porphobilinogen + 2 H2O]. |
Product | Probable delta-aminolevulinic acid dehydratase HemB (porphobilinogen synthase) (ALAD) (ALADH) |
Comments | Rv0512, (MTCY20G10.02), len: 329 aa. Probable hemB, delta-aminolevulinic acid dehydratase, equivalent to 46723|HEM2_MYCLE delta-aminolevulinic acid dehydratase from Mycobacterium leprae (329 aa). Also highly similar to many e.g. P54919|HEM2_STRCO from Streptomyces coelicolor (330 aa); HEM2_ECOLI|P15002 from Escherichia coli (323 aa), FASTA scores: opt: 942, E(): 0, (47.6% identity in 317 aa overlap); etc. Contains PS00169 Delta-aminolevulinic acid dehydratase active site. Belongs to the ALADH family. Cofactor: zinc. |
Functional category | Intermediary metabolism and respiration |
Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). |
Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 604602 | 605591 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0512|hemB MSMSSYPRQRPRRLRSTVAMRRLVAQTSLEPRHLVLPMFVADGIDEPRPITSMPGVVQHTRDSLRRAAAAAVAAGVGGLMLFGVPRDQDKDGVGSAGIDPDGILNVALRDLAKDLGEATVLMADTCLDEFTDHGHCGVLDDRGRVDNDATVARYVELAVAQAESGAHVVGPSGMMDGQVAAIRDGLDAAGYIDVVILAYAAKFASAFYGPFREAVSSSLSGDRRTYQQEPGNAAEALREIELDLDEGADIVMVKPAMGYLDVVAAAADVSPVPVAAYQVSGEYAMIRAAAANNWIDERAAVLESLTGIRRAGADIVLTYWAVDAAGWLT
Bibliography
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant