Gene Rv0638 (secE)
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Essential for protein export. |
Product | Probable preprotein translocase SecE1 |
Comments | Rv0638, (MTCY20H10.19), len: 161 aa. Probable secE1, preprotein translocase (tail-anchored membrane protein) (see citation below), highly similar at C-terminal half to others e.g. P36690|SECE_STRGR preprotein translocase SECE subunit from Streptomyces griseus (86 aa), FASTA scores: opt: 220, E(): 4.6e-06, (35.4% identity in 96 aa overlap); P16920|SECE_ECOLI preprotein translocase sece subunit from Escherichia coli strains K12 and O157:H7 (127 aa), FASTA scores: opt: 122, E(): 0.34, (37.0% identity in 54 aa overlap); etc. Contains PS01067 Protein secE/sec61-gamma signature. Belongs to the SECE/SEC61-gamma family. Part of the prokaryotic protein translocation apparatus which comprise SECA|Rv3240c, SECD|Rv2587c, SECE, SECF|Rv2586c, SECG|Rv1440 and SECY|Rv0732. Note that previously known as secE. |
Functional category | Cell wall and cell processes |
Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS; predicted integral membrane protein (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 733737 | 734222 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0638|secE1 VSDEGDVADEAVADGAENADSRGSGGRTALVTKPVVRPQRPTGKRSRSRAAGADADVDVEEPSTAASEATGVAKDDSTTKAVSKAARAKKASKPKARSVNPIAFVYNYLKQVVAEMRKVIWPNRKQMLTYTSVVLAFLAFMVALVAGADLGLTKLVMLVFG
Bibliography
- Braunstein M and Belisle JT [2000]. http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Retrieve&list_uids=&dopt=Abstract Review
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant