Gene Rv0735
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | The sigma factor is an initiation factor that promotes attachment of the RNA polymerase to specific initiation sites and then is released. |
| Product | Probable alternative RNA polymerase sigma factor SigL |
| Comments | Rv0735, (MTV041.09), len: 177 aa. Probable sigL, alternative RNA polymerase sigma factor (rpoE) (see citations below), highly similar to many proteins of the extracytoplasmatic function (ECF) subfamily e.g. CAB72200.1|AL138851 putative RNA polymerase sigma factor from Streptomyces coelicolor (194 aa); Q06909|CARQ_MYXXA RNA polymerase sigma factor CARQ from Myxococcus xanthus (174 aa), FASTA scores: opt: 251, E(): 9.6e-11, (32.9% identity in 161 aa overlap); etc. Also similar to MTCI61_4, MTU87242_1, and MLU15180_30 from Mycobacterium tuberculosis. Contains PS01063 Sigma-70 factors ECF subfamily signature and probable helix-turn helix motif from aa 139-160 (Score 1134, +3.05 SD). Belongs to the sigma-70 factor family, ECF subfamily. |
| Functional category | Information pathways |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). BALB/c mice infected with M. tuberculosis H37Rv sigL|Rv0735 mutant survive longer than those infected with wild-type (See Hahn et al., 2005). DBA/2 mice infected with M. tuberculosis H37Rv mutated at sigL|Rv0735 and rslA|Rv0736 survive longer than those infected with wild-type (See Dainese et al., 2006). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 827543 | 828076 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0735|sigL
VARVSGAAAAEAALMRALYDEHAAVLWRYALRLTGDAAQAEDVVQETLLRAWQHPEVIGDTARPARAWLFTVARNMIIDERRSARFRNVVGSTDQSGTPEQSTPDEVNAALDRLLIADALAQLSAEHRAVIQRSYYRGWSTAQIATDLGIAEGTVKSRLHYAVRALRLTLQELGVTR
Bibliography
- Gomez JE et al. [1997]. Sigma factors of Mycobacterium tuberculosis. Review
- Chen P, Gomez J and Bishai WR [2000]. Review
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Hahn MY, Raman S, Anaya M and Husson RN [2005]. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. Mutant
- Dainese E et al. [2006]. Posttranslational regulation of Mycobacterium tuberculosis extracytoplasmic-function sigma factor sigma L and roles in virulence and in global regulation of gene expression. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
