Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown; 3-hydroxyisobutyrate dehydrogenase family protein probably involved in cellular metabolism.
ProductProbable dehydrogenase/reductase
CommentsRv0770, (MTCY369.15), len: 295 aa. Probable dehydrogenase/reductase, 3-hydroxyisobutyrate dehydrogenase family, possibly 3-hydroxyisobutyrate dehydrogenase or 2-hydroxy-3-oxopropionate reductase, similar to others e.g. P23523|GARR_ECOLI 2-hydroxy-3-oxopropionate reductase (tartronate semialdehyde reductase) (TSAR) from Escherichia coli strain K12 (294 aa), FASTA scores: opt: 469, E(): 6.7e-22, (34.4% identity in 282 aa overlap); P28811|MMSB_PSEAE 3-hydroxyisobutyrate dehydrogenase (hibadh) from Pseudomonas aeruginosa (298 aa), FASTA scores: opt: 439, E(): 4.3e-20, (34.9% identity in 269 aa overlap); etc. Also similar to others from Mycobacterium tuberculosis e.g. Rv1122 and Rv1844c. Seems to belong to the 3-hydroxyisobutyrate dehydrogenase family.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010).
TranscriptomicsmRNA identified by DNA microarray analysis and up-regulated at high temperatures (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS863256864143+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0770|Rv0770
MTAHPETPRLGYIGLGNQGAPMAKRLLDWPGGLTVFDVRVEAMAPFVEGGATAAASVSDVAEADIISITVFDDAQVSSVITADNGLATHAKPGTIVAIHSTIADTTAVDLAEKLKPQGIHIVDAPVSGGAAAAAKGELAVMVGADDEAFQRIKEPFSRWASLLIHAGEPGAGTRMKLARNMLTFVSYAAAAEAQRLAEACGLDLVALGKVVRHSDSFTGGAGAIMFRNTTAPMEPADPLRPLLEHTRGLGEKDLSLALALGEVVSVDLPLAQLALQRLAAGLGVPHPDTEPAKET