Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThought to be involved in cysteine biosynthesis [catalytic activity: O3-acetyl-L-serine + H(2)S = L-cysteine + acetate].
ProductPossible cysteine synthase a CysK2 (O-acetylserine sulfhydrylase) (O-acetylserine (thiol)-lyase) (CSASE)
CommentsRv0848, (MTV043.41), len: 372 aa. Possible cysK2, cysteine synthase A, but could be also a cysteine synthase B cysM2-product, similar to many e.g. NP_109408.1|NC_002682 cysteine synthase from Mesorhizobium loti (357 aa); Q44004|CYSM_ALCEU cysteine synthase from Alcaligenes eutrophus strain CH34 (Ralstonia eutropha) (339 aa), FASTA scores: opt: 511, E(): 1.7e-25, (35.0% identity in 314 aa overlap); etc. Belongs to the cysteine synthase/cystathionine beta-synthase family. Cofactor: pyridoxal phosphate. Note that previously known as cysM3.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS944938946056+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0848|cysK2
VRSRQTRDRYRLLPEGYQVTPGRNRHPGTMVGNTPVLWIPELSGTSDPDRGFWAKLEGFNPGGMKDRPALYMVECARARGDIAPGAAIVESTGGTLGLGLALAGKVYRHPVTLVTDPGLEPIIARMLTAYGAGVDMVTQPHPVGGWQQARKDRVAQLMAEYPGAWNPNQYGNPDNVGAYRSLALELVAQLGRIDVLVCSVGTGGHSAGVARVLREFNPDMRLIGVDTIGSTIFGQPASNRLMRGLGSSIYPRNVDYRAFDEVHWVAPPEAVWACRSLAATHYASGGWSVGAVALVAGWAARNLPADTTIAAVFPDGPQRYFDTIYNDAYCNEHELLGGQPPTEPDEIASPLDAVVTRWTRSTTVIDPTQVVS