Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionSensor part of the two component regulatory system PRRA/PRRB. Thought to be involved in the environmental adaptation, specifically in an early phase of the intracellular growth.
ProductTwo component sensor histidine kinase PrrB
CommentsRv0902c, (MTCY31.30c), len: 446 aa. PrrB, two-component sensor histidine kinase (see citations below), transmembrane protein, equivalent to MLCB57_26|NP_302403.1|NC_002677 sensor histidine kinase from Mycobacterium leprae (446 aa); and similar at C-termini to NP_301251.1|NC_002677 putative two-component system sensor kinase from Mycobacterium leprae (519 aa). C-terminus also similar to the C-termini of many sensor-like histidine kinase proteins e.g. P08336|CPXA_ECOLI|ECFB|SSD|EUP|B3911|Z5456|ECS4837 sensor protein from Escherichia coli strain K12 (457 aa), FASTA scores: opt: 364, E(): 1.7e-15, (27.1% identity in 398 aa overlap); CAB89748.1|AL354616 putative two-component histidine kinase from Streptomyces coelicolor (483 aa); CAB82845.1|AJ277081 putative histidine kinase from Amycolatopsis mediterranei (472 aa); etc. Also similar in part to Mycobacterium tuberculosis proteins Rv3764c (475 aa); and Rv0982 (504 aa). Thought to be induced at phagocytosis (see Graham & Clark-Curtiss 1999).
Functional categoryRegulatory proteins
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS; predicted integral membrane protein (See Xiong et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomicsmRNA supposedly identified by SCOTS method, 48h after infection of cultured human primary macrophages (see Graham & Clark-Curtiss 1999).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS10045011005841-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0902c|prrB
MNILSRIFARTPSLRTRVVVATAIGAAIPVLIVGTVVWVGITNDRKERLDRRLDEAAGFAIPFVPRGLDEIPRSPNDQDALITVRRGNVIKSNSDITLPKLQDDYADTYVRGVRYRVRTVEIPGPEPTSVAVGATYDATVAETNNLHRRVLLICTFAIGAAAVFAWLLAAFAVRPFKQLAEQTRSIDAGDEAPRVEVHGASEAIEIAEAMRGMLQRIWNEQNRTKEALASARDFAAVSSHELRTPLTAMRTNLEVLSTLDLPDDQRKEVLNDVIRTQSRIEATLSALERLAQGELSTSDDHVPVDITDLLDRAAHDAARIYPDLDVSLVPSPTCIIVGLPAGLRLAVDNAIANAVKHGGATLVQLSAVSSRAGVEIAIDDNGSGVPEGERQVVFERFSRGSTASHSGSGLGLALVAQQAQLHGGTASLENSPLGGARLVLRLPGPS