Gene Rv1033c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Sensor part of the two component regulatory system TRCS/TRCR. Involved in transcriptional autoactivation: TRCR activates its own expression by interacting with the at-rich sequence of the TRCR promoter. |
| Product | Two component transcriptional regulator TrcR |
| Comments | Rv1033c, (MTCY10G2.16), len: 257 aa. TrcR, two-component regulatory protein (see citations below), similar to Q50825 two component response regulator from Mycobacterium tuberculosis (234 aa), FASTA scores: opt: 628, E(): 0, (46.0% identity in 226 aa overlap). Note that in vitro autophosphorylation of TrcS requires the presence of Mn2+or Ca2+as a divalent cation cofactor and subsequent transphosphorylation of TrcR is evident in the presence of TrcS-phosphate and Ca2+. |
| Functional category | Regulatory proteins |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1157963 | 1158736 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1033c|trcR
MTTMSGYTRSQRPRQAILGQLPRIHRADGSPIRVLLVDDEPALTNLVKMALHYEGWDVEVAHDGQEAIAKFDKVGPDVLVLDIMLPDVDGLEILRRVRESDVYTPTLFLTARDSVMDRVTGLTSGADDYMTKPFSLEELVARLRGLLRRSSHLERPADEALRVGDLTLDGASREVTRDGTPISLSSTEFELLRFLMRNPRRALSRTEILDRVWNYDFAGRTSIVDLYISYLRKKIDSDREPMIHTVRGIGYMLRPPE
Bibliography
- Haydel SE et al. [1999]. In vitro evidence of two-component system phosphorylation between the Mycobacterium tuberculosis TrcR/TrcS proteins. Product Regulation Biochemistry
- Ewann F, Jackson M, Pethe K, Cooper A, Mielcarek N, Ensergueix D, Gicquel B, Locht C and Supply P [2002]. Transient requirement of the PrrA-PrrB two-component system for early intracellular multiplication of Mycobacterium tuberculosis. Mutant
- Haydel SE et al. [2002]. Expression, autoregulation, and DNA binding properties of the Mycobacterium tuberculosis TrcR response regulator. Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
