Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv1083, (MTV017.36), len: 88 aa. Conserved hypothetical protein, similar to U15183|MLU15183_9 hypothetical protein from Mycobacterium leprae (167 aa), FASTA scores: opt: 332, E(): 1.2e-13, (58.4% identity in 101 aa overlap). Hydrophobic domain aa 25-43. A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004).
Functional categoryConserved hypotheticals
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS12073831207649+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1083|Rv1083
VNQILLSVIAEGGPGNTGPDFGKASPVGLLVIVLLVIATLFLVRSMNQQLKKVPKSFDRDHPELDQAADEGTDRDGPARPPGPPHESG