Gene Rv1189
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | The sigma factor is an initiation factor that promotes attachment of the RNA polymerase to specific initiation sites and then is released |
| Product | Possible alternative RNA polymerase sigma factor SigI |
| Comments | Rv1189, (MTV005.25-MTCI364.01), len: 290 aa. Possible sigI, alternative RNA polymerase sigma factor (see Gomez et al., 1997; Chen et al., 2000), similar to several e.g. O05767|U87307 extracytoplasmic function alternative sigma factor (sigE) from Mycobacterium smegmatis (204 aa), FASTA scores: opt: 239, E(): 1.3e-09, (32.9% identity in 167 aa overlap). |
| Functional category | Information pathways |
| Transcriptomics | mRNA identified by real-time quantitative RT-PCR during exponential growing cultures. mRNA level increased after mild cold shock (see Chen et al., 2000). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1332092 | 1332964 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1189|sigI
MSQHDPVSAAWRAHRAYLVDLAFRMVGDIGVAEDMVQEAFSRLLRAPVGDIDDERGWLIVVTSRLCLDHIKSASTRRERPQDIAAWHDGDASVSSVDPADRVTLDDEVRLALLIMLERLGPAERVVFVLHEIFGLPYQQIATTIGSQASTCRQLAHRARRKINESRIAASVEPAQHRVVTRAFIEACSNGDLDTLLEVLDPGVAGEIDARKGVVVVGADRVGPTILRHWSHPATVLVAQPVCGQPAVLAFVNRALAGVLALSIEAGKITKIHVLVQPSTLDPLRAELGGG
Bibliography
- Gomez JE et al. [1997]. Sigma factors of Mycobacterium tuberculosis. Review
- Manganelli R et al. [1999]. Differential expression of 10 sigma factor genes in Mycobacterium tuberculosis. Transcriptome
- Chen P, Gomez J and Bishai WR [2000]. Review
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
