Gene Rv1237
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in active transport of sugar across the membrane (import). Responsible for the translocation of the substrate across the membrane. |
| Product | Probable sugar-transport integral membrane protein ABC transporter SugB |
| Comments | Rv1237, (MTV006.09), len: 274 aa. Probable sugB, sugar-transport integral membrane protein ABC transporter (see citation below), equivalent to U15180|MLU1518036 protein MalGM from Mycobacterium leprae (296 aa), FASTA scores: opt: 1571, E(): 0, (89.8% identity in 274 aa overlap). Also similar to numerous bacterial sugar transport protein. Related to Rv2834c|MTCY16B7.08 from Mycobacterium tuberculosis (275 aa), FASTA scores: opt: 370, E(): 2.4e-17, (26.8% identity in 269 aa overlap). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1379855 | 1380679 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1237|sugB
VGARRATYWAVLDTLVVGYALLPVLWIFSLSLKPTSTVKDGKLIPSTVTFDNYRGIFRGDLFSSALINSIGIGLITTVIAVVLGAMAAYAVARLEFPGKRLLIGAALLITMFPSISLVTPLFNIERAIGLFDTWPGLILPYITFALPLAIYTLSAFFREIPWDLEKAAKMDGATPGQAFRKVIVPLAAPGLVTAAILVFIFAWNDLLLALSLTATKAAITAPVAIANFTGSSQFEEPTGSIAAGAIVITIPIIVFVLIFQRRIVAGLTSGAVKG
Bibliography
- Braibant M et al. [2000]. The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. Review Secondary
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Rengarajan J et al. [2005]. Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Mutant
- Titgemeyer F et al. [2007]. A genomic view of sugar transport in Mycobacterium smegmatis and Mycobacterium tuberculosis. Homology
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
