Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in transcriptional mechanism
ProductProbable transcriptional regulatory protein
CommentsRv1353c, (MTCY02B10.17c), len: 261 aa. Probable transcriptional regulatory protein, similar to TER1_ECOLI|P03038 tetracycline repressor protein class a from Escherichia coli (216 aa), FASTA scores, opt: 231, E(): 1.6e-08, (31.3% identity in 211 aa overlap). Helix turn helix motif present at aa 3859 (+3.59 SD). Belongs to the TetR/AcrR family of transcriptional regulators.
Functional categoryRegulatory proteins
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS15192001519985-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1353c|Rv1353c
MQTTPGKRQRRQRGSINPEDIISGAFELAQQVSIDNLSMPLLGKHLGVGVTSIYWYFRKKDDLLNAMTDRALSKYVFATPYIEAGDWRETLRNHARSMRKTFADNPVLCDLILIRAALSPKTARLGAQEMEKAIANLVTAGLSLEDAFDIYSAVSVHVRGSVVLDRLSRKSQSAGSGPSAIEHPVAIDPATTPLLAHATGRGHRIGAPDETNFEYGLECILDHAGRLIEQSSKAAGEVAVRRPTATADAPTPGARAKAVAR