Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in the calvin cycle [catalytic activity: D-ribulose 5-phosphate = D-xylulose 5- phosphate]
ProductProbable ribulose-phosphate 3-epimerase Rpe (PPE) (R5P3E) (pentose-5-phosphate 3-epimerase)
CommentsRv1408, (MTCY21B4.25), len: 232 aa. Probable rpe, ribulose-phosphate 3-epimerase, similar to many e.g. CXEC_ALCEU|P40117 (241 aa), FASTA scores: opt: 638, E(): 1.5e-34, (48.3% identity in 234 aa overlap); and RPE_ECOLI|P32661 ribulose-phosphate 3-epimerase (225 aa), FASTA scores: E(): 0, (46.2% identity in 221 aa overlap). Contains PS01085 Ribulose-phosphate 3-epimerase family signature 1. Belongs to the ribulose-phosphate 3-epimerase family.
Functional categoryIntermediary metabolism and respiration
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS15844991585197+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1408|rpe
VSLMAGSTGGPLIAPSILAADFARLADEAAAVNGADWLHVDVMDGHFVPNLTIGLPVVESLLAVTDIPMDCHLMIDNPDRWAPPYAEAGAYNVTFHAEATDNPVGVARDIRAAGAKAGISVKPGTPLEPYLDILPHFDTLLVMSVEPGFGGQRFIPEVLSKVRAVRKMVDAGELTILVEIDGGINDDTIEQAAEAGVDCFVAGSAVYGADDPAAAVAALRRQAGAASLHLSL