Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown; probably involved in cellular metabolism.
ProductPossible nitrogen fixation related protein
CommentsRv1465, (MTV007.12), len: 162 aa. Possible nitrogen fixation related protein. Equivalent to Z99125|MLCL536.24c nitrogen fixation protein NIFU from Mycobacterium leprae (165 aa), FASTA scores: opt: 870, E(): 0, (81.8% identity in 165 aa overlap). Also similar to O32163|Z99120|NIFU_BACSU NifU-like protein from Bacillus subtilis (147 aa), FASTA scores: opt: 354, E(): 4.1e-17, (38.3% identity in 141 aa overlap) and to AL096839|SCC22.02 hypothetical protein from Streptomyces coelicolor (156 aa), FASTA scores: opt: 569, E(): 1.2e-31, (56.3% identity in 158 aa overlap).
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomicsDNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004).
OperonRv1464 and Rv1465, Rv1465 and Rv1466 are co-transcribed, by RT-PCR (see Roback et al., 2007).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS16527681653256+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1465|Rv1465
VTLRLEQIYQDVILDHYKHPQHRGLREPFGAQVYHVNPICGDEVTLRVALSEDGTRVTDVSYDGQGCSISQAATSVLTEQVIGQRVPRALNIVDAFTEMVSSRGTVPGDEDVLGDGVAFAGVAKYPARVKCALLGWMAFKDALAQASEAFEEVTDERNQRTG