Gene Rv1554
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in interconversion of fumarate and succinate (anaerobic respiration). This hydrophobic component may be required to anchor the catalytic components of the fumarate reductase complex to the cytoplasmic membrane. |
| Product | Probable fumarate reductase [membrane anchor subunit] FrdC (fumarate dehydrogenase) (fumaric hydrogenase) |
| Comments | Rv1554, (MTCY48.11c), len: 126 aa. Probable frdC, fumarate reductase, membrane-anchor subunit, highly similar to others e.g. P03805|FRDC_ECOLI fumarate reductase 15 kDa hydrophobic protein from Escherichia coli strain K12 (131 aa), FASTA scores, opt: 268, E(): 3.9e-10, (31.1% identity in 122 aa overlap); NP_458780.1|NC_003198 fumarate reductase complex subunit C; membrane anchor polypeptide from Salmonella enterica subsp. enterica serovar Typhi (131 aa); P20923|FRDC_PROVU fumarate reductase 15 kDa hydrophobic protein from Proteus vulgaris (131 aa); etc. Note that fumarate reductase forms part of an enzyme complex containing four subunits: a flavoprotein (Rv1552|frdA), an iron-sulfur (Rv1553|frdB), and two hydrophobic anchor proteins (Rv1554|frdC and Rv1555|frdD). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1760175 | 1760555 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1554|frdC
MSAYRQPVERYWWARRRSYLRFMLREISCIFVAWFVLYLMLVLRAVGAGGNSYQRFLDFSANPVVVVLNVVALSFLLLHAVTWFGSAPRAMVIQVRGRRVPARAVLAGHYAAWLVVSVIVAWMVLS
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
