Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionSequence integration/recombination.
ProductProbable integrase/recombinase
CommentsRv1701, (MTCI125.23), len: 311 aa. Probable integrase/recombinase, similar to many e.g. XERD_ECOLI|P21891 integrase/recombinase xerd (298 aa), FASTA scores: opt: 583, E(): 0, (41.8% identity in 311 aa overlap). Also similar to other Mycobacterium tuberculosis integrase/recombinase proteins RV2894c|MTCY274.25c (43.1% identity in 304 aa overlap); and Rv2646|MTCY441.16 phiRv2 integrase (31.1% identity in 161 aa overlap). Equivalent to Z95117|MLCB1351_7 from Mycobacterium leprae (316 aa) (85.4% identity in 316 aa overlap).
Functional categoryInsertion seqs and phages
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al.,2003). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS19262021927137+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1701|Rv1701
MKTLALQLQGYLDHLTIERGVAANTLSSYRRDLRRYSKHLEERGITDLAKVGEHDVSEFLVALRRGDPDSGTAALSAVSAARALIAVRGLHRFAAAEGLAELDVARAVRPPTPSRRLPKSLTIDEVLSLLEGAGGDKPSDGPLTLRNRAVLELLYSTGARISEAVGLDLDDIDTHARSVLLRGKGGKQRLVPVGRPAVHALDAYLVRGRPDLARRGRGTAAIFLNARGGRLSRQSAWQVLQDAAERAGITAGVSPHMLRHSFATHLLEGGADVRVVQELLGHASVTTTQIYTLVTVHALREVWAGAHPRAR