Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible toxin VapC12
CommentsRv1720c, (MTCY04C12.05c), len: 129 aa. Possible vapC12, toxin, part of toxin-antitoxin (TA) operon with Rv1721c, contains PIN domain (See Arcus et al., 2005; Pandey and Gerdes, 2005). Similar to other Mycobacterium tuberculosis hypothetical proteins e.g. O53610|Rv0065|MTV030.08 (133 aa), FASTA scores: E(): 1.5e-10, (39.1% identity in 128 aa overlap); P71550|Rv0960|MTCY10D7.14C (129 aa) and O06415|Rv0549c|MTCY25D10.28C (137 aa).
Functional category-
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS19470301947419-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1720c|vapC12
VIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFTQRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA