Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in glyoxylate bypass, an alternative to the tricarboxylic acid cycle [catalytic activity: isocitrate = succinate + glyoxylate].
ProductProbable isocitrate lyase AceAb [second part] (isocitrase) (isocitratase) (Icl)
CommentsRv1916, (MTCY180.02c), len: 398 aa. Probable aceAb, isocitrate lyase (see citations below). Highly similar to the C-terminus of ACEA_MYCLE|P46831 isocitrate lyase from Mycobacterium leprae (606 aa), FASTA results: opt: 1635, E(): 0, (86.3% identity in 278 aa overlap). Although this ORF and the upstream ORF representing the N-terminal half of aceA could be joined by a frameshift no error is apparent in the cosmid, or in a seqencing read from the genome of H37Rv. As this ORF has a RBS and transcriptional start immediately following the stop of the upstream ORF, it is possible that they are expressed as two separate modules. In Mycobacterium tuberculosis strain CDC1551, aceA exists as a single gene, MT1966: the corresponding protein has been purified experimentally and seems have an active isocitrate lyase activity (see Honer et al., 1999). For Mycobacterium tuberculosis strain H37Rv, immunoblot assay didn't detect AceAa or AceAb products (see Honer et al., 1999) but mRNA of AceAa|Rv1915 has been detected (see Betts et al., 2002); so AceAb|Rv1916 could be a pseudogene. Icl2 has 2-methyl-isocitrate lyase (MCL) activity in M. tuberculosis Erdman (See Munoz-Elias et al., 2006).
Functional categoryIntermediary metabolism and respiration
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). M. tuberculosis Erdman icl1 icl2 mutant is unable to grow on fatty acids, in mice, in macrophages (See Munoz-Elias et al., 2005).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS21615662162762+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1916|aceAb
MTYGEAVADVLEFGQSEGEPIGMAPEEWRAFAARASLHAARAKAKELGADPPWDCELAKTPEGYYQIRGGIPYAIAKSLAAAPFADILWMETKTADLADARQFAEAIHAEFPDQMLAYNLSPSFNWDTTGMTDEEMRRFPEELGKMGFVFNFITYGGHQIDGVAAEEFATALRQDGMLALARLQRKMRLVESPYRTPQTLVGGPRSDAALAASSGRTATTKAMGKGSTQHQHLVQTEVPRKLLEEWLAMWSGHYQLKDKLRVQLRPQRAGSEVLELGIHGESDDKLANVIFQPIQDRRGRTILLVRDQNTFGAELRQKRLMTLIHLWLVHRFKAQAVHYVTPTDDNLYQTSKMKSHGIFTEVNQEVGEIIVAEVNHPRIAELLTPDRVALRKLITKEA