Gene Rv1964
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | -10_signal |
| Function | Unknown |
| Product | Conserved hypothetical integral membrane protein YrbE3A |
| Comments | Rv1964, (MTV051.02), len: 265 aa. YrbE3A, hypothetical unknown integral membrane protein, part of mce3 operon and member of YrbE family (see citations below), highly similar to Mycobacterium tuberculosis proteins O07412|Rv0167|MTCI28.07|yrbE1A (265 aa), O07791|Rv0587|MTCY19H5.35|yrbE2A (265 aa), Rv3501c|MTV023.08c|yrbE4A (254 aa), etc. Also highly similar to conserved hypothetical integral membrane proteins of yrbEA type, e.g. AAD24544.1|AF116213|YrbE1A from Mycobacterium leprae (112 aa); P45392|YRBE_ECOLI from Escherichia coli (260 aa), FASTA scores: opt: 893, E(): 0, (51.4% identity in 253 aa overlap); etc. The transcription of this CDS seems negatively regulated by the product of Rv1963c|mce3R (see Santangelo et al., 2002). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| -10_signal | 2207518 | 2207523 | + |
| -35_signal | 2207496 | 2207501 | + |
| CDS | 2207700 | 2208497 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1964|yrbE3A
MVIVADKAAGRVADPVLRPVGALGDFFAMTLDTSVCMFKPPFAWREYLLQCWFVARVSTLPGVLMTIPWAVISGFLFNVLLTDIGAADFSGTGCAIFTVNQSAPIVTVLVVAGAGATAMCADLGARTIREELDALRVMGINPIQALAAPRVLAATTVSLALNSVVTATGLIGAFFCSVFLMHVSAGAWVTGLTTLTHTVDVVISMIKATLFGLMAGLIACYKGMSVGGGPAGVGRAVNETVVFAFIVLFVINIVVTAVGIPFMVS
Bibliography
- Cole ST et al. [1998]. Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Sequence Secondary
- Tekaia F et al. [1999]. Analysis of the proteome of Mycobacterium tuberculosis in silico. Secondary
- Santangelo MP et al. [2002]. Negative transcriptional regulation of the mce3 operon in Mycobacterium tuberculosis. Regulation Sequence
- Santangelo MP et al. [2002]. Negative transcriptional regulation of the mce3 operon in Mycobacterium tuberculosis. Product Function Regulation
- de la Paz Santangelo M et al. [2009]. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Regulon
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
