Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown; probably involved in cellular metabolism.
ProductPossible dehydrogenase (fragment)
CommentsRv1990A, len: 111 aa. Possible dehydrogenase (fragment), similar to N-terminal part of several dehydrogenases and hypothetical proteins, e.g. Rv2750|MTV002.15|AL008967 from Mycobacterium tuberculosis (272 aa), FASTA scores: opt: 151, E(): 0.0045, (47.45% identity in 78 aa overlap), but lacks C-terminal part. Maybe a pseudogene. Also similar to U17129|RSU17129_7 putative short-chain alcohol dehydrogenase from Rhodococcus erythropolis (275 aa), FASTA scores: opt: 142, E(): 0.018, (54.15% identity in 48 aa overlap). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryIntermediary metabolism and respiration
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS22338812234216-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1990A|Rv1990A
VGRLEGKVAFITGVARGQGRSHAVRLADGQARALGKVDVEACGALVGEVEVWGRDVRDDRRVFVESPADEFGACRRVARQGIRVVGLPVSQRELVEPEAGCAARRSAAGSQ