Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in protein export: required for correct localization of precursor proteins bearing signal peptides with the twin arginine conserved motif S/T-R-R-X-F-L-K. This sec-independent pathway is termed tat for twin-arginine translocation system. This system mainly transports proteins with bound cofactors that require folding prior to export.
ProductSec-independent protein translocase membrane-bound protein TatA
CommentsRv2094c, (MT2155, MTCY49.34c), len: 83 aa. TatA, membrane-bound protein, component of twin-arginine translocation protein export system (see Berks et al., 2000), similar to many. Contains PS00017 ATP/GTP-binding site motif A (P-loop). Belongs to the TATA/E family.
Functional categoryCell wall and cell processes
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomicsmRNA identified by DNA microarray analysis and possibly down-regulated by hspR|Rv0353 and hrcA|Rv2374c (see Stewart et al., 2002).
RegulonPredicted to be in the SigE|Rv1221 regulon during macrophage (THP-1) infection (See Fontan et al., 2008).
OperonpafC|Rv2095c and tatA|Rv2094c are co-transcribed, tatA|Rv2094c and tatC|Rv2093c are co-transcribed, but pafC|Rv2095c to tatC|Rv2093c are not, by RT-PCR (See Festa et al., 2007).
MutantEssential gene, determined by allelic exchange experiments (See Saint-Joanis et al., 2006).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS23530462353297-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2094c|tatA
VGSLSPWHWAILAVVVIVLFGAKKLPDAARSLGKSLRIFKSEVRELQNENKAEASIETPTPVQSQRVDPSAASGQDSTEARPA