Gene Rv2160c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2160c, (MTCY270.08), len: 113 aa. Conserved hypothetical protein, possibly a TetR-family transcriptional regulator, similar to C-terminal half of AL512667_12|Q9AD73|SCK31.01c putative TetR-family transcriptional regulator from Streptomyces coelicolor (200 aa), while Rv2160A is similar to the N-terminal half of 2SCK31.01c. This suggests possible frameshift near 2421978 but sequence of this region has been checked and is also identical in strain CDC1551. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Regulatory proteins |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 4h, 24h and 96h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2421662 | 2422003 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2160c|Rv2160c
VGRIPGTRRAGGCFFAAAAADVDSQPGPVRDRIAATGRAGIAAITADVETAQRRGEIRADIEVRQLAFELHAYAMEANWALLLLDDDGAGERARTAIDAALARVGTTQEGVES
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
