Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductProbable conserved transmembrane protein
CommentsRv2219, (MTCY190.30), len: 250 aa. Probable conserved transmembrane protein. Equivalent to hypothetical membrane protein ML0857 (250 aa) from Mycobacterium leprae Z98741 |MLCB22_13 Mycobacterium leprae cosmid B22; H (250 aa) opt : 1328, E(): 0; 80.8% identity in 250 aa overlap.
Functional categoryCell wall and cell processes
ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS; predicted integral membrane protein (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS24862352486987+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2219|Rv2219
MAKPRNAAESKAAKAQANAARKAAARQRRAQLWQAFTLQRKEDKRLLPYMIGAFLLIVGASVGVGVWAGGFTMFTMIPLGVLLGALVAFVIFGRRAQRTVYRKAEGQTGAAAWALDNLRGKWRVTPGVAATGNLDAVHRVIGRPGVIFVGEGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVPLAKLERHLTRLPANITVKQMDTVESRLAALGSRAGAGVMPKGPLPTTAKMRSVQRTVRRK