Gene Rv2403c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved lipoprotein LppR |
| Comments | Rv2403c, (MTCY253.17), len: 251 aa. Probable lppR, conserved lipoprotein, with weak similarity with mycobacterial serine/threonine protein kinases e.g. AAK45563|MT1304 from Mycobacterium tuberculosis strain CDC1551 (626 aa), FASTA scores: opt: 186, E(): 0.00023, (24.4% identity in 238 aa overlap), and the C-terminal part of Q11053|Rv1266c|MTCY50.16|PKNH_MYCTU from Mycobacterium tuberculosis (626 aa), FASTA scores: opt: 185, E()= 0.00027, (24.35% identity in 238 aa overlap). Has signal peptide and appropriate positioned prokaryotic lipoprotein attachment site (PS00013). Could belong to the Ser/Thr family of protein kinases. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 96h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2700535 | 2701290 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2403c|lppR
VTNRWRWVVPLFAVFLAAGCTTTTTGKAGLAPNAVPRPLMGSLIQRVPLDGAALSTLLNQPFQALPPFPPVFGGSDSLGDSDVSARPADCVGVGYLTQRNVYRSVEVKSVARVSWRHDGSSVKVDDVDEGVVALPSAAAADDLFARFSAQWKECDGTTLTVPASAFGQRSITDVRVADSVVAATVSLRRGTHSILASVPQARAVGVRGNCVVEVAVTFFGITHPSDQGSADISTSAVDIAHAMMDRISELS
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
