Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in translation mechanisms.
Product50S ribosomal protein L21 RplU
CommentsRv2442c, (MTCY428.04), len: 104 aa. rplU, 50S ribosomal protein L21, equivalent to Q9CBZ2|RL21_MYCLE from Mycobacterium leprae (103 aa), FASTA scores: opt: 579, E(): 4.8e-31, (91.1% identity in 102 aa overlap). Also highly similar to others e.g. P95756|RL21_STRGR from Streptomyces griseus (106 aa), FASTA scores: opt: 362, E(): 5.4e-17, (56.0% identity in 100 aa overlap); etc.
Functional categoryInformation pathways
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and up-regulated after 4h and 24h of starvation (see citation below).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS27400472740361-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2442c|rplU
MMATYAIVKTGGKQYKVAVGDVVKVEKLESEQGEKVSLPVALVVDGATVTTDAKALAKVAVTGEVLGHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVTGIA