Gene Rv2450c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to promote the resuscitation and growth of dormant, nongrowing cells. Could also stimulate the growth of several other high G+C gram+ organisms, e.g. Mycobacterium avium, Mycobacterium bovis (BCG), Mycobacterium kansasii, Mycobacterium smegmatis. |
| Product | Probable resuscitation-promoting factor RpfE |
| Comments | Rv2450c, (MTV008.06c), len: 172 aa. Probable rpfE, resuscitation-promoting factor (see Mukamolova et al., 1998), similar to O86308|Z96935|MLRPF_1 RPF protein precursor from Micrococcus luteus (220 aa), FASTA scores: opt: 291, E(): 3e-7, (48.75% identity in 80 aa overlap). C-terminus is similar to other Mycobacterial rpf proteins e.g. O05594|Rv1009|MTCI237.26|RPFB probable resuscitation-promoting factor from Mycobacterium tuberculosis (362 aa), FASTA scores: opt: 344, E(): 1.4e-09, (42.85% identity in 147 aa overlap); etc. C-terminal region similar to N-terminal region of Q9F2Q2|SCE41.06c putative secreted protein from Streptomyces coelicolor (244 aa), FASTA scores: opt: 355, E(): 3.1e-10, (56.65% identity in 90 aa overlap). Also similar to Q9F2Q1|SCE41.07c putative secreted protein from Streptomyces coelicolor (near Q9F2Q2|SCE41.06c) (341 aa) FASTA scores: opt: 317, E(): 2.5e-08, (51.7% identity in 87 aa overlap). With Mycobacterium leprae, high similarity between the two corresponding C-terminal regions of two hypothetical proteins, Q9CD53|ML0240 (375 aa), FASTA scores: opt: 339, E(): 2.5e-09, (59.15% identity in 93 aa overlap) and O33049|MLCB57.05c|ML2151 (174 aa), FASTA scores: opt: 329, E(): 4e-09, (58.14% identity in 86 aa overlap). Contains a possible secretory signal sequence in N-terminus. Possible autocrine and/or paracrine bacterial growth factor or cytokine (see citations below). Interacts with RipA (see Hett et al., 2007). Predicted possible vaccine candidate (See Zvi et al., 2008). |
| Functional category | Cell wall and cell processes |
| Proteomics | Predicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). |
| Transcriptomics | mRNA identified by microarray analysis; transcription up-regulated at low pH in vitro conditions, which may mimic an environmental signal encountered by phagocytosed bacteria (see Fisher et al., 2002). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Non essential gene by specialized transduction in M. tuberculosis Erdman; growth and persistence of mutant in mice are not attenuated (See Tufariello et al., 2004). M. tuberculosis H37Rv rpfACBD, rpfACBE, rpfACDE, and rpfACBED mutants show no growth defects in broth culture; growth of rpfACBD and rpfACBE mutants in human peripheral blood mononuclear cells is unaffected but growth in B6D2/F1 mice is attenuated (See Kana et al., 2008). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2751662 | 2752180 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2450c|rpfE
LKNARTTLIAAAIAGTLVTTSPAGIANADDAGLDPNAAAGPDAVGFDPNLPPAPDAAPVDTPPAPEDAGFDPNLPPPLAPDFLSPPAEEAPPVPVAYSVNWDAIAQCESGGNWSINTGNGYYGGLRFTAGTWRANGGSGSAANASREEQIRVAENVLRSQGIRAWPVCGRRG
Bibliography
- Mukamolova GV et al. [1998]. A bacterial cytokine. Secondary Function
- Fisher MA, Plikaytis BB and Shinnick TM [2002]. Microarray analysis of the Mycobacterium tuberculosis transcriptional response to the acidic conditions found in phagosomes. Transcriptome Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Tufariello JM et al. [2004]. Individual Mycobacterium tuberculosis resuscitation-promoting factor homologues are dispensable for growth in vitro and in vivo. Mutant
- Hett EC et al. [2007]. A partner for the resuscitation-promoting factors of Mycobacterium tuberculosis. Function
- MÃ¥len H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- Kana BD et al. [2008]. The resuscitation-promoting factors of Mycobacterium tuberculosis are required for virulence and resuscitation from dormancy but are collectively dispensable for growth in vitro. Mutant
- Zvi A et al. [2008]. Whole genome identification of Mycobacterium tuberculosis vaccine candidates by comprehensive data mining and bioinformatic analyses. Immunology
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant