Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThought to promote the resuscitation and growth of dormant, nongrowing cells. Could also stimulate the growth of several other high G+C gram+ organisms, e.g. Mycobacterium avium, Mycobacterium bovis (BCG), Mycobacterium kansasii, Mycobacterium smegmatis.
ProductProbable resuscitation-promoting factor RpfE
CommentsRv2450c, (MTV008.06c), len: 172 aa. Probable rpfE, resuscitation-promoting factor (see Mukamolova et al., 1998), similar to O86308|Z96935|MLRPF_1 RPF protein precursor from Micrococcus luteus (220 aa), FASTA scores: opt: 291, E(): 3e-7, (48.75% identity in 80 aa overlap). C-terminus is similar to other Mycobacterial rpf proteins e.g. O05594|Rv1009|MTCI237.26|RPFB probable resuscitation-promoting factor from Mycobacterium tuberculosis (362 aa), FASTA scores: opt: 344, E(): 1.4e-09, (42.85% identity in 147 aa overlap); etc. C-terminal region similar to N-terminal region of Q9F2Q2|SCE41.06c putative secreted protein from Streptomyces coelicolor (244 aa), FASTA scores: opt: 355, E(): 3.1e-10, (56.65% identity in 90 aa overlap). Also similar to Q9F2Q1|SCE41.07c putative secreted protein from Streptomyces coelicolor (near Q9F2Q2|SCE41.06c) (341 aa) FASTA scores: opt: 317, E(): 2.5e-08, (51.7% identity in 87 aa overlap). With Mycobacterium leprae, high similarity between the two corresponding C-terminal regions of two hypothetical proteins, Q9CD53|ML0240 (375 aa), FASTA scores: opt: 339, E(): 2.5e-09, (59.15% identity in 93 aa overlap) and O33049|MLCB57.05c|ML2151 (174 aa), FASTA scores: opt: 329, E(): 4e-09, (58.14% identity in 86 aa overlap). Contains a possible secretory signal sequence in N-terminus. Possible autocrine and/or paracrine bacterial growth factor or cytokine (see citations below). Interacts with RipA (see Hett et al., 2007). Predicted possible vaccine candidate (See Zvi et al., 2008).
Functional categoryCell wall and cell processes
ProteomicsPredicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007).
TranscriptomicsmRNA identified by microarray analysis; transcription up-regulated at low pH in vitro conditions, which may mimic an environmental signal encountered by phagocytosed bacteria (see Fisher et al., 2002).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Non essential gene by specialized transduction in M. tuberculosis Erdman; growth and persistence of mutant in mice are not attenuated (See Tufariello et al., 2004). M. tuberculosis H37Rv rpfACBD, rpfACBE, rpfACDE, and rpfACBED mutants show no growth defects in broth culture; growth of rpfACBD and rpfACBE mutants in human peripheral blood mononuclear cells is unaffected but growth in B6D2/F1 mice is attenuated (See Kana et al., 2008).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS27516622752180-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2450c|rpfE
LKNARTTLIAAAIAGTLVTTSPAGIANADDAGLDPNAAAGPDAVGFDPNLPPAPDAAPVDTPPAPEDAGFDPNLPPPLAPDFLSPPAEEAPPVPVAYSVNWDAIAQCESGGNWSINTGNGYYGGLRFTAGTWRANGGSGSAANASREEQIRVAENVLRSQGIRAWPVCGRRG
      
Bibliography