Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionHydrolyses DNA (this enzyme may play a significant role in processes leading to recovery from mutagenesis and/or cell death by alkylating agents).
ProductPossible DNA glycosylase
CommentsRv2464c, (MT2539, MTV008.20c), len: 268 aa. Possible DNA glycosylase, showing some similarity to several other DNA glycosylases e.g. Q9F308|SCC80.11c putative DNA repair hydrolase (fragment) from Streptomyces coelicolor (306 aa), FASTA scores: opt: 894, E(): 6.1e-51, (51.05% identity in 282 aa overlap); O50606|MUTM|FPG_THETH formamidopyrimidine-DNA glycosylase from Thermus aquaticus (267 aa), FASTA scores: opt: 342, E(): 4.6e-15, (32.4% identity in 250 aa overlap); Q9RCW5|SCM10.34c putative formamidopyrimidine-DNA glycosylase from Streptomyces coelicolor (287 aa), FASTA scores: opt: 321, E(): 1.1e-13, (29.35% identity in 259 aa overlap); etc. Identical to AAK46839|MT2539 formamidopyrimidine-DNA glycosylase from Mycobacterium tuberculosis strain CDC1551. Also similar to other Mycobacterium tuberculosis DNA glycosylases e.g. MTCY71.37 (32.9% identity in 277 aa overlap). Belongs to the FPG family.
Functional categoryInformation pathways
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS27668592767665-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2464c|Rv2464c
VPEGHTLHRLARLHQRRFAGAPVSVSSPQGRFADSASALNGRVLRRASAWGKHLFHHYVGGPVVHVHLGLYGTFTEWARPTDGWLPEPAGQVRMRMVGAEFGTDLRGPTVCESIDDGEVADVVARLGPDPLRSDANPSSAWSRITKSRRPIGALLMDQTVIAGVGNVYRNELLFRHRIDPQRPGRGIGEPEFDAAWNDLVSLMKVGLRRGKIIVVRPEHDHGLPSYLPDRPRTYVYRRAGEPCRVCGGVIRTALLEGRNVFWCPVCQT