Gene Rv2464c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Hydrolyses DNA (this enzyme may play a significant role in processes leading to recovery from mutagenesis and/or cell death by alkylating agents). |
| Product | Possible DNA glycosylase |
| Comments | Rv2464c, (MT2539, MTV008.20c), len: 268 aa. Possible DNA glycosylase, showing some similarity to several other DNA glycosylases e.g. Q9F308|SCC80.11c putative DNA repair hydrolase (fragment) from Streptomyces coelicolor (306 aa), FASTA scores: opt: 894, E(): 6.1e-51, (51.05% identity in 282 aa overlap); O50606|MUTM|FPG_THETH formamidopyrimidine-DNA glycosylase from Thermus aquaticus (267 aa), FASTA scores: opt: 342, E(): 4.6e-15, (32.4% identity in 250 aa overlap); Q9RCW5|SCM10.34c putative formamidopyrimidine-DNA glycosylase from Streptomyces coelicolor (287 aa), FASTA scores: opt: 321, E(): 1.1e-13, (29.35% identity in 259 aa overlap); etc. Identical to AAK46839|MT2539 formamidopyrimidine-DNA glycosylase from Mycobacterium tuberculosis strain CDC1551. Also similar to other Mycobacterium tuberculosis DNA glycosylases e.g. MTCY71.37 (32.9% identity in 277 aa overlap). Belongs to the FPG family. |
| Functional category | Information pathways |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2766859 | 2767665 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2464c|Rv2464c
VPEGHTLHRLARLHQRRFAGAPVSVSSPQGRFADSASALNGRVLRRASAWGKHLFHHYVGGPVVHVHLGLYGTFTEWARPTDGWLPEPAGQVRMRMVGAEFGTDLRGPTVCESIDDGEVADVVARLGPDPLRSDANPSSAWSRITKSRRPIGALLMDQTVIAGVGNVYRNELLFRHRIDPQRPGRGIGEPEFDAAWNDLVSLMKVGLRRGKIIVVRPEHDHGLPSYLPDRPRTYVYRRAGEPCRVCGGVIRTALLEGRNVFWCPVCQT
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
