Gene Rv2478c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2478c, (MTV008.34c), len: 161 aa. Conserved hypothetical protein, with weak similarity with many single-strand binding proteins e.g. Q9X8U3|SCH24.29 putative single-strand binding protein from Streptomyces coelicolor (199 aa), FASTA scores: opt: 246, E(): 4.5e-08, (31.5% identity in 162 aa overlap); P46390|SSB_MYCLE|ML2684|MLCB1913.20c single-strand binding protein (SSB) (helix-destabilizing protein) from Mycobacterium leprae (168 aa), FASTA scores: opt: 239, E(): 1e-07, (30.8% identity in 146 aa overlap); P18310|SSBF_ECOLI single-strand binding protein from Escherichia coli (178 aa), FASTA scores: opt: 116, E(): 2.9, (25.7% identity in 140 aa overlap); etc. Also similarity with Rv0054|P71711|MTCY21D4.17|SSB_MYCTU probable single-strand binding protein from M. tuberculosis (164 aa), FASTA scores: opt: 234, E(): 2e-07, (31.75% identity in 148 aa overlap). N-terminus shorter 8 aa from AAK46855|MT2553 single-strand DNA binding protein from Mycobacterium tuberculosis strain CDC1551. |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2784123 | 2784608 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2478c|Rv2478c
VVGHIVNDLQRRKVGDQEVVKFRVASNSRRRTSDGGWEPGNSLFITVNCWGRLVTGVGAALGKGAPVIVVGHVYTSEYEDRDGIRRSSLEMRATSVGPDLSRVIVRIEKPAYTGPSAGDLPAATGTGAAGAADAPASAADSVSDVVVDDAITGHNPLPISA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
