Gene Rv2497c 
in Mycobacterium tuberculosis H37Rv
General annotation
      | Type | CDS | 
| Function | Involved in energy metabolism. The branched-chain alpha-keto acid dehydrogenase complex catalyzes the overall conversion of branched chain alpha-keto acids to acyl-CoA and CO2. It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3). | 
| Product | Probable branched-chain keto acid dehydrogenase E1 component, alpha subunit BkdA | 
| Comments | Rv2497c, (MTCY07A7.03c), len: 367 aa. Probable bkdA, branched-chain keto acid dehydrogenase E1 component, alpha subunit, similar to many e.g. Q9Y8I5|PDHA from Halobacterium volcanii (Haloferax volcanii) (368 aa) FASTA scores: opt: 961, E(): 1.3e-52, (45.6% identity in 351 aa overlap); BAB40585 from Bacillus sp. UTB2301 (356 aa) FASTA scores: opt: 947, E(): 9.1e-52, (43.1% identity in 355 aa overlap); Q9KG99|BH0213 from Bacillus halodurans (367 aa), FASTA scores: opt: 896, E(): 1.4e-48, (42.65% identity in 340 aa overlap); etc. Also similar to several putative branched-chain alpha keto acid dehydrogenases E1, beta subunit, alternate name : 2-oxoisovalerate dehydrogenase, e.g. Q53592|BKDA from Streptomyces avermitilis (381 aa), FASTA scores: opt: 980, E(): 8.5e-54, (45.65% identity in 370 aa overlap); etc. Previously known as pdhA. | 
| Functional category | Intermediary metabolism and respiration | 
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). | 
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 24h and 96h of starvation (see citation below). | 
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 2810993 | 2812096 | - | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium tuberculosis H37Rv|Rv2497c|bkdA
MGEGSRRPSGMLMSVDLEPVQLVGPDGTPTAERRYHRDLPEETLRWLYEMMVVTRELDTEFVNLQRQGELALYTPCRGQEAAQVGAAACLRKTDWLFPQYRELGVYLVRGIPPGHVGVAWRGTWHGGLQFTTKCCAPMSVPIGTQTLHAVGAAMAAQRLDEDSVTVAFLGDGATSEGDVHEALNFAAVFTTPCVFYVQNNQWAISMPVSRQTAAPSIAHKAIGYGMPGIRVDGNDVLACYAVMAEAAARARAGDGPTLIEAVTYRLGPHTTADDPTRYRSQEEVDRWATLDPIPRYRTYLQDQGLWSQRLEEQVTARAKHVRSELRDAVFDAPDFDVDEVFTTVYAEITPGLQAQREQLRAELARTD
      
    Bibliography
    - Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Tian J, Bryk R, Shi S, Erdjument-Bromage H, Tempst P and Nathan C [2005]. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Function
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Venugopal A et al. [2011]. Virulence of Mycobacterium tuberculosis depends on lipoamide dehydrogenase, a member of three multienzyme complexes. Operon Product
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant